PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g28020.1.p
Common NameBRADI_2g28020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 339aa    MW: 37268.2 Da    PI: 4.3394
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g28020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM63.65.9e-20111405128
               NAM   5 frFhPtdeelvveyLkkkvegkkleleev.ikevdiyk.vePwdLpk....kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +rF+ t  e v +yL + ++g++l+ +e  i+++diy  +eP+dL +    + kae++   +fF+  ++++ + +r+ r++ +g+W  + +  
  Bradi2g28020.1.p  11 CRFDLTPLEAVAYYLPRLLSGESLNGAERlIHRADIYGdLEPNDLAAafppAPKAERTgARFFFTLCKRQKGSRTRSARSAGAGTWTCQRT-L 102
                       6999999****************7776656******9626*****8446764444445366**************************9877.5 PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +v+++ g ++g  k L f kg +++ e+t Wvm+ey+ 
  Bradi2g28020.1.p 103 DVVDHAGVKKGEMKHLSFKKGIKKEKESTGWVMEEYHC 140
                       56666999*************99999**********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100519.8857160IPR003441NAC domain
PfamPF023652.7E-1011139IPR003441NAC domain
SuperFamilySSF1019412.48E-2012159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MDPADEMFQL CRFDLTPLEA VAYYLPRLLS GESLNGAERL IHRADIYGDL EPNDLAAAFP  60
PAPKAERTGA RFFFTLCKRQ KGSRTRSARS AGAGTWTCQR TLDVVDHAGV KKGEMKHLSF  120
KKGIKKEKES TGWVMEEYHC LLPEAVVADG EMVLCKIHLS QRPKSSPGIR REQEDQPAPM  180
PVATTMKRPA PVAADHLRCP KRARVAAFMP SLADGGDIDL LAGLVSAQEQ EPAVEAAEEG  240
NMMEDRLSCT VEELLGGAAT DEEFFDFTAV EAEQQQVVDL PIVASHENFD LGFDFTAVEE  300
EQQIVDFDLD LPVLDEDALS EIMLSRDEDD VPMSLVLG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239527.11e-130PREDICTED: uncharacterized protein LOC104585199
TrEMBLA0A0Q3G5T70.0A0A0Q3G5T7_BRADI; Uncharacterized protein
STRINGBRADI2G28020.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18322799
Representative plantOGRP9262314
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.12e-09NAC domain containing protein 89